PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa21991s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 87aa    MW: 9552.09 Da    PI: 9.4244
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa21991s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind203.12.9e-62187203289
       GAGA_bind 203 lDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhW 289
                     +D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRi+grKmSqgafkk+LekLa+eGy+++n++DLk+hW
  Csa21991s010.1   1 MDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEGYSFGNAIDLKSHW 87 
                     8************************************************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.4E-13187IPR010409GAGA-binding transcriptional activator
PfamPF062173.1E-58187IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MDISGLPVPV CTCTGTPQQC YRWGCGGWQS ACCTTNISMY PLPMSTKRRG ARISGRKMSQ  60
GAFKKVLEKL ATEGYSFGNA IDLKSHW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545891e-108AC254589.1 Capsella rubella clone CAP16-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010502189.13e-60PREDICTED: protein BASIC PENTACYSTEINE1
RefseqXP_010502201.13e-60PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD07e-61BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLR0HH849e-60R0HH84_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__107__AT2G01930.14e-59(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61692647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.24e-62basic pentacysteine1